PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G030200.1.p
Common NameSb06g003100, SORBIDRAFT_06g003100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 354aa    MW: 38570.9 Da    PI: 8.2273
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G030200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-161462148
                          TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                          +g+W++eEd +l++ ++++G+g +W + +++ g++R++k+c++rw++yl
  Sobic.006G030200.1.p 14 KGPWSPEEDAKLKEFIEKHGTGgNWIALPQKAGLRRCGKSCRLRWLNYL 62
                          79*********************************************97 PP

2Myb_DNA-binding33.21.2e-1069111246
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           g +T+ Ed  +    +  G++ W+ Ia+ ++ gRt++++k++w++
  Sobic.006G030200.1.p  69 GEFTENEDRVICSMYASIGSR-WSIIASQLP-GRTDNDIKNYWNT 111
                           789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.884966IPR017930Myb domain
SuperFamilySSF466891.92E-2711109IPR009057Homeodomain-like
SMARTSM007179.4E-131364IPR001005SANT/Myb domain
PfamPF002491.1E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-241569IPR009057Homeodomain-like
CDDcd001676.09E-101662No hitNo description
SMARTSM007176.9E-1067115IPR001005SANT/Myb domain
PROSITE profilePS5129415.8867117IPR017930Myb domain
PfamPF002492.6E-969111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2270117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGRAPCCDKN NVKKGPWSPE EDAKLKEFIE KHGTGGNWIA LPQKAGLRRC GKSCRLRWLN  60
YLRPNIKHGE FTENEDRVIC SMYASIGSRW SIIASQLPGR TDNDIKNYWN TKLKKKLLGS  120
TAAPHPHRAP RQHHHHHRPG LNLMLQQHTS SPSLPQATYN SFFSGAGGAL HHHDPIISAL  180
ALPPPHHQDY MLSSGAGLGI PTNAPSSSLL HAQQQFQQQH HHQQVVKEES GSMIVFGSDQ  240
QSCSSSDGGG AHSHSQTHAQ FGHGHGKDLS FDGYLFGYNN GGSMEHDNRL LLHQLQDGHQ  300
QVAPVEYNYE EIKQLLMSTT AAGSLHGHGG HEDGGGMEGF GGGGGSQGKV TMM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0962051e-125FP096205.1 Phyllostachys edulis cDNA clone: bphylf043l07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002446179.10.0hypothetical protein SORBIDRAFT_06g003100
TrEMBLC5YD700.0C5YD70_SORBI; Putative uncharacterized protein Sb06g003100
STRINGSb06g003100.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-75myb domain protein 36